PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010558668.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 400aa    MW: 44602.6 Da    PI: 6.8651
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010558668.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.84e-162872147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT  E++++v+a kq+G   W++I +++g ++t+ q++s+ qk+
   XP_010558668.1 28 RERWTDGEHKKFVEALKQYGRA-WRRIQEHIG-TKTAVQIRSHAQKF 72
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.24E-152278IPR009057Homeodomain-like
PROSITE profilePS5129418.0332377IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-82574IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-152675IPR006447Myb domain, plants
SMARTSM007176.3E-122775IPR001005SANT/Myb domain
PfamPF002491.1E-122871IPR001005SANT/Myb domain
CDDcd001672.06E-83073No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MMQLNEQISG GNNSASKARK PYTITKERER WTDGEHKKFV EALKQYGRAW RRIQEHIGTK  60
TAVQIRSHAQ KFFSKIARET AGSNGSSVER IVIPPPRPKR KPMHPYPRKL GNPSAKEISG  120
TDQSRRSVSP PDLSVSEGDD QSPTSVLSSV CSDAFGSADT NSPNSILSPV SSTLPCELTL  180
SGPYGSTTTF AIEEAESLTL ELFGRERRLL SREESINPPK KQSLKLFGKT VEVKDTCCTR  240
SPLDSNEEKP IQPFLWKLSP EENILCWIQK HKQEGENSNG LEPRNLDAKE GGHQEEGSSG  300
GSNSCGSDDD DDTDRGEADK DSEVEEETPT TSHERKEIGV PEFKRSERSA FRQLKGTRPE  360
LQTKAFVPYK KRKMGIETED RYSGKRRETG EDGDICLLCL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1204211RERRLLSR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010558667.10.0PREDICTED: protein REVEILLE 1-like isoform X1
SwissprotF4KGY67e-96RVE1_ARATH; Protein REVEILLE 1
TrEMBLE4MX623e-97E4MX62_EUTHA; mRNA, clone: RTFL01-17-B24
TrEMBLV4N7S53e-97V4N7S5_EUTSA; Uncharacterized protein
STRINGAT5G17300.12e-93(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.15e-78MYB_related family protein